Updated Website

.github/workflows/build-and-test.yml

@@ -20,7 +20,7 @@ jobs:
     - name: Install dependencies
       run: |
         sudo apt-get update
-        sudo apt-get install -y gcc g++ cmake golang uuid-dev
+        sudo apt-get install -y gcc g++ cmake golang uuid-dev libssl-dev lcov
 
     - name: Run pre-build script
       run: |
@@ -30,3 +30,37 @@ jobs:
 
     - name: Run unit tests
       run: ./build_linux64/Output/amc_unittest
+
+  coverage:
+    runs-on: ubuntu-latest
+    needs: build-and-test
+    if: ${{ success() }}
+
+    steps:
+    - name: Checkout repository
+      uses: actions/checkout@v4
+
+    - name: Install dependencies
+      run: |
+        sudo apt-get update
+        sudo apt-get install -y gcc g++ cmake golang uuid-dev libssl-dev lcov
+
+    - name: Run pre-build script (hashes and baseline)
+      run: |
+        chmod +x ./build_clean_linux64.sh
+        ./build_clean_linux64.sh
+      shell: bash
+
+    - name: Run coverage (unit tests)
+      run: |
+        chmod +x ./coverage_linux.sh
+        ./coverage_linux.sh
+      shell: bash
+
+    - name: Upload coverage report
+      uses: actions/upload-artifact@v4
+      with:
+        name: coverage-report
+        path: |
+          build_coverage/coverage_html
+          build_coverage/coverage.info

.gitignore

@@ -13,6 +13,8 @@ build_win64
 build_linux64
 build_rpi
 build_client
+build_coverage
+build_clientdist_tools
 ACT/LibMC_component
 ACT/LibMCDriverEnv_component
 ACT/LibMCDriver_component
@@ -25,6 +27,14 @@ Client/.DS_Store
 Client/node_modules
 Client/dist
 Client/dist.xml
+Client/vue2/.DS_Store
+Client/vue2/node_modules
+Client/vue2/dist
+Client/vue2/dist.xml
+Client/vue3/.DS_Store
+Client/vue3/node_modules
+Client/vue3/dist
+Client/vue3/dist.xml
 
 # local env files
 Client/.env.local
@@ -44,7 +54,30 @@ Client/*.njsproj
 Client/*.sln
 Client/*.sw?
 
+ClientV3/.DS_Store
+ClientV3/node_modules
+ClientV3/dist
+ClientV3/dist.xml
+
+# local env files
+ClientV3/.env.local
+ClientV3/.env.*.local
+
+# Log files
+ClientV3/npm-debug.log*
+ClientV3/yarn-debug.log*
+ClientV3/yarn-error.log*
+
+# Editor directories and files
+ClientV3/.idea
+ClientV3/.vscode
+ClientV3/*.suo
+ClientV3/*.ntvs*
+ClientV3/*.njsproj
+ClientV3/*.sln
+ClientV3/*.sw?
+
 Framework/HeadersCore/Go
 Drivers/ScanLab/Dependencies
 Drivers/ScanLab/BinaryData
-Drivers/Marlin/BinaryData
+Drivers/Marlin/BinaryData

ACT/LibMC.xml

@@ -705,7 +705,84 @@
 		<error name="INVALIDROWRANGE" code="680" description="Invalid row range." />
 		<error name="CONFIGURATIONLISTNAMEMISSING" code="681" description="Configuration list name missing" />
 		<error name="CONFIGURATIONLISTBUTTONNAMEMISSING" code="682" description="Configuration list button name missing" />
-
+		<error name="NONLINEAROVERRIDEPARAMETERNOTINCREASING" code="683" description="Nonlinear override parameter not increasing" />
+		<error name="NONLINEAROVERRIDEPARAMETEROUTOFRANGE" code="684" description="Nonlinear override parameter out of range" />
+		<error name="NONLINEAROVERRIDEFACTOROUTOFRANGE" code="685" description="Nonlinear override factor out of range" />
+		<error name="EMPTYSIGNALINSTANCENAME" code="686" description="Empty signal instance name" />
+		<error name="INVALIDSIGNALINSTANCENAME" code="687" description="Invalid signal instance name" />
+		<error name="COULDNOTFINDSIGNAL" code="688" description="Could not find signal" />
+		<error name="DUPLICATESIGNALINSTANCENAME" code="689" description="Duplicate signal instance name" />
+		<error name="SIGNALINSTANCENOTFOUND" code="690" description="Signal instance not found" />
+		<error name="INVALIDSIGNALARCHIVETIMEOUT" code="691" description="Invalid signal archive timeout" />
+		<error name="UNKNOWNTELEMETRYCHANNELTYPE" code="692" description="Unknown telemetry channel type." />
+		<error name="INVALIDTELEMETRYCHANNELIDENTIFIER" code="693" description="Invalid telemetry channel identifier." />
+		<error name="TELEMETRYCHANNELALREADYEXISTS" code="694" description="Telemetry channel already exists." />
+		<error name="TELEMETRYCHANNELNOTFOUND" code="695" description="Telemetry channel not found." />					
+		<error name="TELEMETRYMARKERHASALREADYBEENFINISHED" code="696" description="Telemetry marker has already been finished." />
+		<error name="INVALIDTELEMETRYMARKERFINISHTIMESTAMP" code="697" description="Invalid telemetry marker finish timestamp." />
+		<error name="UNFINISHEDTELEMETRYMARKERSHAVENODURATION" code="698" description="Unfinished telemetry marker have no duration." />					
+		<error name="TELEMETRYMARKERALREADYREGISTERED" code="699" description="Telemetry Marker has been already registered." />					
+		<error name="TELEMETRYCHUNKSTARTTIMESTAMPAFTEREND" code="700" description="Telemetry Chunk Start timestamp is after end timestamp." />					
+		<error name="TELEMETRYCHUNKINDEXOUTOFRANGE" code="701" description="Telemetry Chunk index out of range." />	
+		<error name="TELEMETRYCHUNKIDMISMATCH" code="702" description="Telemetry Chunk ID mismatch." />	
+		<error name="TELEMETRYCHUNKISREADONLY" code="703" description="Telemetry Chunk is readonly." />	
+		<error name="TELEMETRYCHUNKSCANONLYBEARCHIVEDIFREADONLY" code="704" description="Telemetry Chunks can only be archived if readonly." />			
+		<error name="INVALIDTELEMETRYCHANNELTYPE" code="705" description="Invalid telemetry channel type." />	
+		<error name="MISSINGTELEMETRYCHANNELIDENTIFIER" code="706" description="Missing telemetry channel identifier." />	
+		<error name="MISSINGTELEMETRYCHANNELDESCRIPTION" code="707" description="Missing telemetry channel description." />	
+		<error name="XMLNODEHASNULLNAMESPACE" code="708" description="XML node has a null namespace. Ensure the XML document declares a namespace on the root element." />				
+		<error name="RESOURCEENTRYSIZISMISMATCH" code="709" description="Resource entry size mismatch between index and ZIP content." />
+		<error name="RESOURCEENTRYCHECKSUMMISMATCH" code="710" description="Resource entry SHA256 checksum mismatch." />
+		<error name="INVALIDRESOURCEENTRYSHA256" code="711" description="Invalid resource entry SHA256 value." />
+		<error name="SESSIONVARIABLENOTFOUND" code="712" description="Session variable not found." />
+		<error name="DUPLICATESESSIONVARIABLE" code="713" description="Duplicate session variable." />
+		<error name="INVALIDSESSIONVARIABLENAME" code="714" description="Invalid session variable name." />
+		<error name="MISSINGSESSIONVARIABLENAME" code="715" description="Missing session variable name." />
+		<error name="MISSINGSESSIONVARIABLETYPE" code="716" description="Missing session variable type." />
+		<error name="INVALIDSESSIONREFERENCE" code="717" description="Invalid session reference in UI expression." />
+		<error name="INVALIDTELEMETRYSETTING" code="718" description="Invalid telemetry setting." />
+		<error name="INVALIDTOOLPATHPROFILEINDEX" code="719" description="Invalid toolpath profile index." />
+		<error name="INVALIDTOOLPATHMODIFIERINDEX" code="720" description="Invalid toolpath modifier index." />
+		<error name="INVALIDOPERATIONTYPENAME" code="721" description="Invalid operation type name. MUST be a non-empty alphanumeric identifier." />
+		<error name="OPERATIONTYPENOTFOUND" code="722" description="Operation type not found." />
+		<error name="OPERATIONTYPEDEFINITIONMISMATCH" code="723" description="Operation type or parameter already registered with a different definition." />
+		<error name="OPERATIONTARGETSTATENOTFOUND" code="724" description="Target state of the operation type does not exist in the state machine." />
+		<error name="INVALIDOPERATIONPARAMETERNAME" code="725" description="Invalid operation parameter name. MUST be an alphanumeric identifier and MUST NOT be a reserved attribute name." />
+		<error name="OPERATIONPARAMETERNOTFOUND" code="726" description="Operation parameter not found." />
+		<error name="INVALIDOPERATIONPARAMETERDEFAULT" code="727" description="Default value of the operation parameter is outside of its range or not a valid enum option." />
+		<error name="OPERATIONITEMLISTNOTFOUND" code="728" description="Operation item list not found." />
+		<error name="OPERATIONITEMLISTFULL" code="729" description="Operation item list has reached its maximum item count." />
+		<error name="INVALIDOPERATIONSEQUENCENAME" code="730" description="Invalid operation sequence name. MUST be a non-empty alphanumeric identifier." />
+		<error name="OPERATIONSEQUENCENOTFOUND" code="731" description="Operation sequence not found." />
+		<error name="INVALIDOPERATIONSEQUENCEXML" code="732" description="Operation sequence XML is malformed or has an unknown root element or namespace." />
+		<error name="OPERATIONSEQUENCEVALIDATIONFAILED" code="733" description="Operation sequence validation failed." />
+		<error name="OPERATIONSEQUENCEREVISIONCONFLICT" code="734" description="A newer revision of the operation sequence has been published in the meantime." />
+		<error name="OPERATIONSEQUENCEISPUBLISHED" code="735" description="Published operation sequences are immutable. Create a working copy to make changes." />
+		<error name="OPERATIONNOTFOUND" code="736" description="Operation not found in the sequence." />
+		<error name="OPERATIONPARAMETEREVALUATIONFAILED" code="737" description="An operation parameter value could not be evaluated." />
+		<error name="OPERATIONSEQUENCEEXECUTIONNOTFOUND" code="738" description="Operation sequence execution not found." />
+		<error name="OPERATIONSEQUENCEEXECUTIONNOTRUNNING" code="739" description="Operation sequence execution is not running." />
+		<error name="NOOPERATIONDISPATCHED" code="740" description="No operation has been dispatched in this state machine." />
+		<error name="OPERATIONVALUETYPEMISMATCH" code="741" description="Operation parameter cannot be returned in the requested type." />
+		<error name="OPERATIONDISPATCHERTRANSITIONMISSING" code="742" description="A dispatcher state is missing an outstate to an operation target state, or a target state is missing an outstate back to the dispatcher." />
+		<error name="OPERATIONSEQUENCESTORAGEFAILED" code="743" description="The operation sequence revision could not be stored in the database." />
+		<error name="OPERATIONSEQUENCEREGISTRYNOTFOUND" code="744" description="No operation sequence registry exists for the state machine instance." />
+		<error name="OPERATIONTYPEREGISTRATIONNOTALLOWED" code="745" description="Operation types can only be registered from the state environment of the owning state machine." />
+		<error name="INVALIDOPERATIONITEMINDEX" code="746" description="Invalid operation item index." />
+		<error name="INVALIDOPERATIONINDEX" code="747" description="Invalid operation index." />
+		<error name="INVALIDOPERATIONSEQUENCEISSUEINDEX" code="748" description="Invalid operation sequence issue index." />
+		<error name="INVALIDOPERATIONENUMOPTIONINDEX" code="749" description="Invalid operation enum option index." />
+		<error name="OPERATIONPARAMETERHASNORANGE" code="750" description="Operation parameter has no range." />
+		<error name="INVALIDOPERATIONEXPRESSIONMODE" code="751" description="Invalid operation expression mode for this parameter type." />
+		<error name="MISSINGOPERATIONSEQUENCEEDITORSTATEMACHINE" code="752" description="The operationsequenceeditor element requires a statemachine attribute." />
+		<error name="OPERATIONSEQUENCEEDITNOTPERMITTED" code="753" description="The user is not permitted to edit operation sequences." />
+		<error name="INVALIDOPERATIONSEQUENCEJSON" code="754" description="Invalid operation sequence JSON." />
+		<error name="OPERATIONICONRESOURCENOTFOUND" code="755" description="Operation icon resource not found." />
+
+
+
+
+
 	</errors>
 
 
@@ -727,6 +804,7 @@
 	</enum>	
 
 	<enum name="StreamConnectionType">
+		<option name="Unknown" value="0"/>
 		<option name="JSONEventStream" value="1"/>
 		<option name="JPEGImageStream" value="2"/>
 	</enum>	
@@ -764,6 +842,14 @@
 			<param name="StreamType" type="enum" class="StreamConnectionType" pass="return" description="Content type of the stream." />	
 		</method>
 
+		<method name="SetResumeEventID" description="Sets the last event ID that the client has already received, taken from the SSE Last-Event-ID header. Must be called before the first GetNewContent call. Streams that do not support resuming ignore it.">
+			<param name="EventID" type="uint64" pass="in" description="Last event ID the client has received. 0 means that no resume point is known and a full snapshot is sent." />	
+		</method>
+
+		<method name="IsActive" description="Returns if the stream connection is still active. Returns false once the underlying stream has ended, for example because its session was closed. The caller should then terminate the connection.">
+			<param name="IsActive" type="bool" pass="return" description="Flag if the stream connection is still active." />	
+		</method>
+
 	</class>
 
 
@@ -838,6 +924,11 @@
 			<param name="XMLString" type="string" pass="in" description="XML Configuration String." />
 		</method>
 
+		<method name="SetParameterOverride" description="overrides a parameter with a certain value. Fails if parameter group or parameter does not exist. Fails if Value is not fitting the parameter type.">
+			<param name="ParameterPath" type="string" pass="in" description="Path of the parameter. Example: main.configgroup.currentjob" />
+			<param name="ParameterValue" type="string" pass="in" description="New Value of the parameter" />
+		</method>
+
 		<method name="StartAllThreads" description="starts the threads for all the state machines.">
 		</method>